General Information

  • ID:  hor001867
  • Uniprot ID:  A0A8C2T551
  • Protein name:  vasoactive intestinal peptide
  • Gene name:  VIP
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVFTDNYSRF
  • Length:  10(132-141)
  • Propeptide:  MEHRGASPLLLALALLSALCWRARALPPRGATFPAVPRLGNRLPFDAASESDRAHGSLKSESDILQNTLPENEKFYFDLSRIIDRNARHADGIFTSVYSHLLAKLAVKRYLHSLIRKRVSSQDSPVKRHSDAVFTDNYSRFRKQMAVKKYLNSVLTGKRSQEELNPAKLRDEAEILEPSFSENYDDVSVDELLSHLPLDL
  • Signal peptide:  MEHRGASPLLLALALLSALCWRARA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001867_AF2.pdbhor001867_ESM.pdb

Physical Information

Mass: 138002 Formula: C56H78N14O17
Absent amino acids: CEGHIKLMPQW Common amino acids: F
pI: 6.34 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: -27 Boman Index: -2458
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 2826 Extinction Coefficient cystines: 1490
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  20298575
  • Title:  Neuropeptidomic Analysis of the Embryonic Japanese Quail Diencephalon